быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cytokeratin 4 (KRT4) Rabbit mAb (A0013)
- Описание
- Характеристики
-
Overview
Product name Cytokeratin 4 (KRT4) Rabbit mAb Catalog No. A0013 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1804 Background
The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in differentiated layers of the mucosal and esophageal epithelia with family member KRT13. Mutations in these genes have been associated with White Sponge Nevus, characterized by oral, esophageal, and anal leukoplakia. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 4 (KRT4) (P19013). Sequence MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQGACFGGAGGFGTGGFGGGFGGSFSGKGGPG Gene ID Swiss Prot Synonyms K4; CK4; CK-4; CYK4; WSN1 Calculated MW 56kDa Observed MW 57kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples A549, A-431, Mouse stomach Cellular location cell surface, cytosol, intermediate filament cytoskeleton, nucleus 
Western blot analysis of extracts of various cell lines, using Cytokeratin 4 (KRT4) (KRT4) Rabbit mAb (A0013) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded human lung squamous carcinoma tissue using Cytokeratin 4 (KRT4) (KRT4) Rabbit mAb (A0013) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Confocal imaging of human tonsil using Cytokeratin 4 (KRT4) Rabbit mAb (A0013, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 4 (KRT4) (P19013). Isotype IgG