быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
KIFC1 Rabbit mAb (A0077)
- Описание
- Характеристики
-
Overview
Product name KIFC1 Rabbit mAb Catalog No. A0077 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1808 Background
Predicted to enable microtubule binding activity and minus-end-directed microtubule motor activity. Involved in mitotic metaphase plate congression and mitotic spindle assembly. Located in membrane.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIFC1 (Q9BW19). Sequence MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVPSLTTVPQTQGQTTAQKVSKKTGPRCSTAIA Gene ID Swiss Prot Synonyms HSET; KNSL2 Calculated MW 74kDa Observed MW 74kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, NIH/3T3 Cellular location early endosome, microtubule organizing center, mitotic spindle, nucleus 
Western blot analysis of extracts of various cell lines, using KIFC1 antibody (A0077) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human appendix using KIFC1 Rabbit mAb (A0077) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH-3T3 cells using KIFC1 Rabbit mAb (A0077) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using KIFC1 Rabbit mAb (A0077) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIFC1 (Q9BW19). Isotype IgG