быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CaMK2 delta/CAMK2 gamma Rabbit mAb (A0186)
- Описание
- Характеристики
-
Overview
Product name CaMK2 delta/CAMK2 gamma Rabbit mAb Catalog No. A0186 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53334 Background
The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a beta chain. It is possible that distinct isoforms of this chain have different cellular localizations and interact differently with calmodulin. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CaMK2 delta/CAMK2 gamma (Q13554). Sequence CGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL Gene ID Swiss Prot Synonyms CAM2; CAMK2; CAMKB; MRD54; CaMKIIbeta Calculated MW 73kDa Observed MW 50kDa/60kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IP Recommended dilution - WB 1:500 - 1:1000
- IP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples RD, U-251MG, Mouse brain, Rat brain Cellular location cytoplasm, cytosol, microtubule organizing center, nucleoplasm 
Western blot analysis of extracts of various cell lines, using CaMK2 delta/CAMK2 gamma Rabbit mAb (A0186) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of extracts of various cell lines, using CaMK2 delta/CAMK2 gamma Rabbit mAb (A0186) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s. -
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CaMK2 delta/CAMK2 gamma (Q13554). Isotype IgG