быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
QKI Rabbit mAb (A0193)
- Описание
- Характеристики
-
Overview
Product name QKI Rabbit mAb Catalog No. A0193 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2500 Background
The protein encoded by this gene is an RNA-binding protein that regulates pre-mRNA splicing, export of mRNAs from the nucleus, protein translation, and mRNA stability. The encoded protein is involved in myelinization and oligodendrocyte differentiation and may play a role in schizophrenia. Multiple transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 242-341 of human QKI (Q96PU8). Sequence RTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN Gene ID Swiss Prot Synonyms QK; Hqk; QK1; QK3; hqkI Calculated MW 38kDa Observed MW 38kDa/40kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples SKOV3, NIH/3T3, U-251MG, Neuro-2a, Mouse brain, Rat brain, Rat heart Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using QKI antibody (A0193) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using QKI Rabbit mAb (A0193) at dilution of 1:1000 (40x lens).Perform microwave antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human placenta using QKI Rabbit mAb (A0193) at dilution of 1:1000 (40x lens).Perform microwave antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse colon using QKI Rabbit mAb (A0193) at dilution of 1:1000 (40x lens).Perform microwave antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat colon using QKI Rabbit mAb (A0193) at dilution of 1:1000 (40x lens).Perform microwave antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH/3T3 cells using QKI Rabbit mAb (A0193) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of NIH/3T3 cells using 3 μg QKI antibody (A0193). Western blot was performed from the immunoprecipitate using QK1 antibody (A0193) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 242-341 of human QKI (Q96PU8). Isotype IgG