быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CaMKII Rabbit mAb (A0198)
- Описание
- Характеристики
-
Overview
Product name CaMKII Rabbit mAb Catalog No. A0198 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1814 Background
The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a beta chain. It is possible that distinct isoforms of this chain have different cellular localizations and interact differently with calmodulin. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CaMKII (NP_741960.1). Sequence GVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK Gene ID Swiss Prot Synonyms CAM2; CAMK2; CAMKB; MRD54; CaMKIIbeta Calculated MW 73kDa Observed MW 50kDa/55kDa/60kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples SH-SY5Y, U-251MG, Mouse brain, Rat brain, C6 Cellular location Cytoplasm, Cytoplasmic side, Peripheral membrane protein, Sarcoplasmic reticulum membrane, centrosome, cytoskeleton, microtubule organizing center Customer validation WB(Homo sapiens, Mus musculus)
Western blot analysis of extracts of various cell lines, using CaMKII Rabbit mAb (A0198) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Western blot analysis of extracts of various cell lines, using CaMKII Rabbit mAb (A0198) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded rat brain using CaMKII Rabbit mAb (A0198) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human brain using CaMKII Rabbit mAb (A0198) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using CaMKII Rabbit mAb (A0198) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CaMKII (NP_741960.1). Isotype IgG