быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HLA-DRB4 Rabbit mAb (A0439)
- Описание
- Характеристики
-
Overview
Product name HLA-DRB4 Rabbit mAb Catalog No. A0439 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2505 Background
HLA-DRB4 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells. The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. There are multiple pseudogenes of this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HLA-DRB4 (P13762). Sequence TERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNG Gene ID Swiss Prot Synonyms DR4; DRB4; HLA-DRB; HLA-DR4B; HLA-DRB4 Calculated MW 30kDa Observed MW 30kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Raji Cellular location Cell membrane, Endoplasmic reticulum membrane, Endosome membrane, Golgi apparatus, Late endosome membrane, Lysosome membrane, Single-pass type I membrane protein, Trans-Golgi network membrane 
Western blot analysis of extracts of Raji cells, using HLA-DRB4 antibody (A0439) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HLA-DRB4 (P13762). Isotype IgG







