быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Desmocollin 3 Rabbit mAb (A0445)
- Описание
- Характеристики
-
Overview
Product name Desmocollin 3 Rabbit mAb Catalog No. A0445 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2506 Background
The protein encoded by this gene is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation. The desmosomal family members are arranged in two clusters on chromosome 18, occupying less than 650 kb combined. Mutations in this gene are a cause of hypotrichosis and recurrent skin vesicles disorder. The protein can act as an autoantigen in pemphigus diseases, and it is also considered to be a biomarker for some cancers. Alternative splicing of this gene results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 797-896 of human Desmocollin 3 (Q14574). Sequence HHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKLHRCNQNEDRMPSQDYVLTYNYEGRGSPAGSVGCCSEKQEEDGLDFLNNLEPKFITLAEACTKR Gene ID Swiss Prot Synonyms DSC; DSC1; DSC2; DSC4; CDHF3; HT-CP Calculated MW 100kDa Observed MW 100kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples TE-1 Cellular location Cell junction, Cell-cell junction, Cytoplasm, Desmosome, Extracellular region, Plasma membrane 
Western blot analysis of extracts of TE-1 cells, using Desmocollin 3 antibody (A0445) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 797-896 of human Desmocollin 3 (Q14574). Isotype IgG







