быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MRPL28 Rabbit mAb (A0452)
- Описание
- Характеристики
-
Overview
Product name MRPL28 Rabbit mAb Catalog No. A0452 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2507 Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein, a part of which was originally isolated by its ability to recognize tyrosinase in an HLA-A24-restricted fashion.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MRPL28 (NP_006419.2). Sequence MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKR Gene ID Swiss Prot Synonyms p15; MAAT1 Calculated MW 30kDa Observed MW 30kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples HeLa, 293T, K-562, Mouse kidney, Mouse heart, Rat kidney, Rat heart, Ratpancreas Cellular location Mitochondrion 
Western blot analysis of extracts of various cell lines, using MRPL28 antibody (A0452) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using MRPL28 antibody (A0452) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of NIH/3T3 cells using MRPL28 Rabbit mAb (A0452) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using MRPL28 Rabbit mAb (A0452) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of K-562 cells using 3 μg MRPL28 antibody (A0452). Western blot was performed from the immunoprecipitate using MRPL28 antibody (A0452) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MRPL28 (NP_006419.2). Isotype IgG