быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SSCA1/SerpinB3 Rabbit mAb (A0455)
- Описание
- Характеристики
-
Overview
Product name SSCA1/SerpinB3 Rabbit mAb Catalog No. A0455 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2508 Background
Enables cysteine-type endopeptidase inhibitor activity; protease binding activity; and virus receptor activity. Involved in several processes, including autocrine signaling; paracrine signaling; and regulation of cellular protein metabolic process. Located in cytoplasmic vesicle; extracellular exosome; and nucleus.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 301-390 of human SSCA1/SerpinB3 (P29508). Sequence TMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP Gene ID Swiss Prot Synonyms SCC; T4-A; SCCA1; SSCA1; SCCA-1; HsT1196; SCCA-PD Calculated MW 45kDa Observed MW Refer to figures Applications
Reactivity Human, Mouse, Rat Tested applications IHC-P Recommended dilution - IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Positive samples Cellular location Cytoplasm 
Immunohistochemistry analysis of paraffin-embedded human cervical using SSCA1/SerpinB3 Rabbit mAb (A0455) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Mouse skin using SSCA1/SerpinB3 Rabbit mAb (A0455) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat bladder using SSCA1/SerpinB3 Rabbit mAb (A0455) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 301-390 of human SSCA1/SerpinB3 (P29508). Isotype IgG