быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
EXOSC7 Rabbit mAb (A0501)
- Описание
- Характеристики
-
Overview
Product name EXOSC7 Rabbit mAb Catalog No. A0501 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2510 Background
Predicted to enable 3'-5'-exoribonuclease activity and RNA binding activity. Predicted to be involved in RNA metabolic process. Part of exosome (RNase complex).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EXOSC7 (Q15024). Sequence MASVTLSEAEKVYIVHGVQEDLRVDGRGCEDYRCVEVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDCSASATPEFEGRGGDD Gene ID Swiss Prot Synonyms p8; EAP1; RRP42; Rrp42p; hRrp42p Calculated MW 32kDa Observed MW 37kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, A-431, NIH/3T3, K-562 Cellular location Cytoplasm, Nucleus, nucleolus 
Western blot analysis of extracts of various cell lines, using EXOSC7 antibody (A0501) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EXOSC7 (Q15024). Isotype IgG