быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GBP1 Rabbit mAb (A0570)
- Описание
- Характеристики
-
Overview
Product name GBP1 Rabbit mAb Catalog No. A0570 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2521 Background
Guanylate binding protein expression is induced by interferon. Guanylate binding proteins are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP) and are distinguished from the GTP-binding proteins by the presence of 2 binding motifs rather than 3.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 493-592 of human GBP1 (P32455). Sequence RVKAESAQASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKMRRRKACTIS Gene ID Swiss Prot Synonyms GBP1; guanylate-binding protein 1 Calculated MW 68kDa Observed MW 50-55\68kDa Applications
Reactivity Human, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, Jurkat, Rat heart Cellular location Cell membrane, Cytoplasm, Cytoplasmic side, Golgi apparatus membrane, Lipid-anchor, Secreted 
Western blot analysis of extracts of various cell lines, using GBP1 antibody (A0570) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human lung cancer using GBP1 Rabbit mAb (A0570) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 493-592 of human GBP1 (P32455). Isotype IgG