быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Pumilio 1 Rabbit mAb (A0571)
- Описание
- Характеристики
-
Overview
Product name Pumilio 1 Rabbit mAb Catalog No. A0571 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1830 Background
This gene encodes a member of the PUF family, evolutionarily conserved RNA-binding proteins related to the Pumilio proteins of Drosophila and the fem-3 mRNA binding factor proteins of C. elegans. The encoded protein contains a sequence-specific RNA binding domain comprised of eight repeats and N- and C-terminal flanking regions, and serves as a translational regulator of specific mRNAs by binding to their 3' untranslated regions. The evolutionarily conserved function of the encoded protein in invertebrates and lower vertebrates suggests that the human protein may be involved in translational regulation of embryogenesis, and cell development and differentiation. Alternatively spliced transcript variants encoding different isoforms have been described.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 104-203 of human Pumilio 1 (Q14671). Sequence NNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTSDHSVSQPIMVQRRPGQSFHVNSE Gene ID Swiss Prot Synonyms PUMH; HSPUM; PUMH1; PUML1; SCA47 Calculated MW 126kDa Observed MW 140kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Jurkat, Mouse testis Cellular location Cytoplasm, Cytoplasmic granule, P-body 
Western blot analysis of extracts of various cell lines, using Pumilio 1 Rabbit mAb (A0571) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of U-2 OS cells using Pumilio 1 Rabbit mAb (A0571) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 104-203 of human Pumilio 1 (Q14671). Isotype IgG







