быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PIST/GOPC Rabbit mAb (A0582)
- Описание
- Характеристики
-
Overview
Product name PIST/GOPC Rabbit mAb Catalog No. A0582 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1831 Background
This gene encodes a Golgi protein with a PDZ domain. The PDZ domain is globular and proteins which contain them bind other proteins through short motifs near the C-termini. Mice which are deficient in the orthologous protein have globozoospermia and are infertile. Multiple transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PIST/GOPC (Q9HD26). Sequence MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVD Gene ID Swiss Prot Synonyms CAL; FIG; PIST; GOPC1; dJ94G16.2 Calculated MW 51kDa Observed MW 59kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HepG2, U-87MG, Rat brain, Mouse lung Cellular location Cell junction, Cell projection, Cytoplasm, Golgi apparatus, Golgi apparatus membrane, Peripheral membrane protein, dendrite, postsynaptic cell membrane, postsynaptic density, synapse, trans-Golgi network membrane 
Western blot analysis of extracts of various cell lines, using PIST/GOPC Rabbit mAb (A0582) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of Mouse lung, using PIST/GOPC Rabbit mAb (A0582) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using PIST/GOPC Rabbit mAb (A0582) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using PIST/GOPC Rabbit mAb (A0582) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using PIST/GOPC Rabbit mAb (A0582) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PIST/GOPC (Q9HD26). Isotype IgG