быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CRMP3/DPYSL4 Rabbit mAb (A0624)
- Описание
- Характеристики
-
Overview
Product name CRMP3/DPYSL4 Rabbit mAb Catalog No. A0624 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2530 Background
Enables filamin binding activity. Predicted to be involved in nervous system development. Predicted to be located in cytosol.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CRMP3/DPYSL4 (O14531). Sequence MSFQGKKSIPRITSDRLLIRGGRIVNDDQSFYADVHVEDGLIKQIGENLIVPGGIKTIDAHGLMVLPGGVDVHTRLQMPVLGMTPADDFCQGTKAALAGG Gene ID Swiss Prot Synonyms CRMP3; DRP-4; ULIP4 Calculated MW 62kDa Observed MW 63kDa Applications
Reactivity Rat Tested applications WB Recommended dilution - WB 1:2000 - 1:6000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples C6 Cellular location cytosol 
Western blot analysis of extracts from C6 cells, using CRMP3/DPYSL4 antibody (A0624) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CRMP3/DPYSL4 (O14531). Isotype IgG