быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Lysozyme (LYZ) Rabbit mAb (A0641)
- Описание
- Характеристики
-
Overview
Product name Lysozyme (LYZ) Rabbit mAb Catalog No. A0641 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0276 Background
This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (LYZ) (P61626). Sequence MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCS Gene ID Swiss Prot Synonyms LZM; LYZF1 Calculated MW 17kDa Observed MW 15kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HepG2, RAW 264.7, THP-1, U-937, Mouse lung Cellular location Secreted Customer validation IF(Mus musculus)
Western blot analysis of extracts of various cell lines, using Lysozyme (LYZ) Rabbit mAb (A0641) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of human lung cancer using Lysozyme (LYZ) Rabbit mAb (A0641) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (LYZ) (P61626). Isotype IgG