быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Histone H1.2 Rabbit mAb (A0646)
- Описание
- Характеристики
-
Overview
Product name Histone H1.2 Rabbit mAb Catalog No. A0646 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1836 Background
Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H1.2 (P16403). Sequence MSETAPAAPAAAPPAEKAPVKKKAAKKAGGTPRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTG Gene ID Swiss Prot Synonyms H1C; H1.2; H1F2; H1s-1; HIST1H1C Calculated MW 21kDa Observed MW 32kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:1000 -1:5000
- IF/ICC 1:50 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, Hep G2, Raji, Mouse thymus, Rat lung Cellular location nucleus 
Western blot analysis of extracts from various cell lines, using Histone H1.2 antibody (A0646) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts from various cell lines, using Histone H1.2 antibody (A0646) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Confocal imaging of U-2 OS cells using Histone H1.2 Rabbit mAb (A0646, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H1.2 (P16403). Isotype IgG