быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CPT2 Rabbit mAb (A0653)
- Описание
- Характеристики
-
Overview
Product name CPT2 Rabbit mAb Catalog No. A0653 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0516 Background
The protein encoded by this gene is a nuclear protein which is transported to the mitochondrial inner membrane. Together with carnitine palmitoyltransferase I, the encoded protein oxidizes long-chain fatty acids in the mitochondria. Defects in this gene are associated with mitochondrial long-chain fatty-acid (LCFA) oxidation disorders.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 559-658 of human CPT2 (P23786). Sequence LRHLAAAKGIILPELYLDPAYGQINHNVLSTSTLSSPAVNLGGFAPVVSDGFGVGYAVHDNWIGCNVSSYPGRNAREFLQCVEKALEDMFDALEGKSIKS Gene ID Swiss Prot Synonyms CPT1; IIAE4; CPTASE Calculated MW 74kDa Observed MW 70kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, HepG2, Mouse liver, Mouse heart, Rat liver, Rat heart Cellular location Matrix side, Mitochondrion inner membrane, Peripheral membrane protein Customer validation WB(Mus musculus)
Western blot analysis of extracts of various cell lines, using CPT2 Rabbit mAb (A0653) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Western blot analysis of extracts of various cell lines, using CPT2 Rabbit mAb (A0653) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 559-658 of human CPT2 (P23786). Isotype IgG