быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
RCC1 Rabbit mAb (A0662)
- Описание
- Характеристики
-
Overview
Product name RCC1 Rabbit mAb Catalog No. A0662 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1834 Background
Enables several functions, including guanyl-nucleotide exchange factor activity; nucleosomal DNA binding activity; and protein heterodimerization activity. Involved in several processes, including G1/S transition of mitotic cell cycle; regulation of mitotic nuclear division; and spindle organization. Located in chromatin; cytoplasm; and nucleus. Part of protein-containing complex.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RCC1 (P18754). Sequence MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALG Gene ID Swiss Prot Synonyms CHC1; RCC1-I Calculated MW 45kDa Observed MW 49kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, Raji, SH-SY5Y, Mouse spleen, Mouse thymus, Rat testis Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using RCC1 Rabbit mAb (A0662) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using RCC1 Rabbit mAb (A0662) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded human placenta using RCC1 Rabbit mAb (A0662) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RCC1 (P18754). Isotype IgG