быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HBG1 Rabbit mAb (A0670)
- Описание
- Характеристики
-
Overview
Product name HBG1 Rabbit mAb Catalog No. A0670 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1837 Background
The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. [provided by RefSeq, Jul 2008]Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 68-147 of human HBG1 (P69891). Sequence VLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH Gene ID Swiss Prot Synonyms HBG-T2; HBGA; HBGR; HSGGL1; PRO2979 Calculated MW 16kDa Observed MW 12kDa Applications
Reactivity Human Tested applications WB IF/ICC Recommended dilution - WB 1:100 - 1:500
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples K-562 Cellular location cytosol, hemoglobin complex 
Western blot analysis of extracts of K-562 cells, using HBG1 antibody (A0670) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunofluorescence analysis of human placenta using HBG1 Rabbit mAb (A0670) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 68-147 of human HBG1 (P69891). Isotype IgG