быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SUOX Rabbit mAb (A0733)
- Описание
- Характеристики
-
Overview
Product name SUOX Rabbit mAb Catalog No. A0733 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2535 Background
Sulfite oxidase is a homodimeric protein localized to the intermembrane space of mitochondria. Each subunit contains a heme domain and a molybdopterin-binding domain. The enzyme catalyzes the oxidation of sulfite to sulfate, the final reaction in the oxidative degradation of the sulfur amino acids cysteine and methionine. Sulfite oxidase deficiency results in neurological abnormalities which are often fatal at an early age. Alternative splicing results in multiple transcript variants encoding identical proteins.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SUOX (P51687). Sequence IWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALYAVHNQSHVRELLAQYKIGELNPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPP Gene ID Swiss Prot Synonyms SUOX; sulfite oxidase Calculated MW 60kDa Observed MW 60kDa Applications
Reactivity Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Rat kidney Cellular location Mitochondrion intermembrane space 
Western blot analysis of extracts of Rat kidney, using SUOX antibody (A0733) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SUOX (P51687). Isotype IgG