быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
hnRNP K Rabbit mAb (A0772)
- Описание
- Характеристики
-
Overview
Product name hnRNP K Rabbit mAb Catalog No. A0772 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0512 Background
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene is located in the nucleoplasm and has three repeats of KH domains that binds to RNAs. It is distinct among other hnRNP proteins in its binding preference; it binds tenaciously to poly(C). This protein is also thought to have a role during cell cycle progession. Several alternatively spliced transcript variants have been described for this gene, however, not all of them are fully characterized.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human hnRNP K (P61978). Sequence METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEI Gene ID Swiss Prot Synonyms AUKS; CSBP; TUNP; HNRPK Calculated MW 49kDa/51kDa Observed MW 58-62kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, NIH/3T3, PC-12, HepG2, Mouse brain, Rat brain Cellular location Cell projection, Cytoplasm, Nucleus, Nucleoplasm, Podosome 
Western blot analysis of extracts of various cell lines, using hnRNP K antibody (A0772) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded rat brain using hnRNP K Rabbit mAb (A0772) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human esophageal using hnRNP K Rabbit mAb (A0772) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse brain using hnRNP K Rabbit mAb (A0772) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Confocal imaging of U-2 0S cells using hnRNP K Rabbit mAb (A0772, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human hnRNP K (P61978). Isotype IgG