быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Erlin-2 Rabbit mAb (A0781)
- Описание
- Характеристики
-
Overview
Product name Erlin-2 Rabbit mAb Catalog No. A0781 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2538 Background
This gene encodes a member of the SPFH domain-containing family of lipid raft-associated proteins. The encoded protein is localized to lipid rafts of the endoplasmic reticulum and plays a critical role in inositol 1, 4, 5-trisphosphate (IP3) signaling by mediating ER-associated degradation of activated IP3 receptors. Mutations in this gene are a cause of spastic paraplegia-18 (SPG18). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Erlin-2 (O94905). Sequence HLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKL Gene ID Swiss Prot Synonyms NET32; SPFH2; SPG18; C8orf2; Erlin-2 Calculated MW 38kDa Observed MW 43kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T, PC-3, OVCAR3, C2C12 Cellular location Endoplasmic reticulum membrane, Single-pass type II membrane protein 
Western blot analysis of extracts of various cell lines, using Erlin-2 antibody (A0781) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using Erlin-2 Rabbit mAb (A0781) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat ovary using Erlin-2 Rabbit mAb (A0781) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Erlin-2 (O94905). Isotype IgG