быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD58 Rabbit mAb (A0806)
- Описание
- Характеристики
-
Overview
Product name CD58 Rabbit mAb Catalog No. A0806 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2540 Background
This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. The protein is localized to the plasma membrane. Alternatively spliced transcript variants have been described.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD58 (P19256). Sequence MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDE Gene ID Swiss Prot Synonyms ag3; LFA3; LFA-3 Calculated MW 28kDa Observed MW 55-70kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples K-562 Cellular location Cell membrane, GPI-anchor, Lipid-anchor, Single-pass type I membrane protein 
Western blot analysis of extracts of K-562 cells, using CD58 antibody (A0806) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD58 (P19256). Isotype IgG