быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MVD Rabbit mAb (A0813)
- Описание
- Характеристики
-
Overview
Product name MVD Rabbit mAb Catalog No. A0813 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2541 Background
The enzyme mevalonate pyrophosphate decarboxylase catalyzes the conversion of mevalonate pyrophosphate into isopentenyl pyrophosphate in one of the early steps in cholesterol biosynthesis. It decarboxylates and dehydrates its substrate while hydrolyzing ATP.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human MVD (P53602). Sequence PSFAQLTMKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAEFVAAVWHGFPPGSNGDTFLKGLQVRPAPL Gene ID Swiss Prot Synonyms MPD; MDDase; POROK7; FP17780 Calculated MW 43kDa Observed MW 43kDa Applications
Reactivity Human, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, Rat brain Cellular location cytosol 
Western blot analysis of extracts of various cell lines, using MVD antibody (A0813) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human MVD (P53602). Isotype IgG