быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Islet1 Rabbit mAb (A0871)
- Описание
- Характеристики
-
Overview
Product name Islet1 Rabbit mAb Catalog No. A0871 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0511 Background
This gene encodes a member of the LIM/homeodomain family of transcription factors. The encoded protein binds to the enhancer region of the insulin gene, among others, and may play an important role in regulating insulin gene expression. The encoded protein is central to the development of pancreatic cell lineages and may also be required for motor neuron generation. Mutations in this gene have been associated with maturity-onset diabetes of the young.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Islet1 (P61371). Sequence YAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQ Gene ID Swiss Prot Synonyms Isl-1; ISLET1 Calculated MW 39kDa Observed MW 45kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T, K-562, Rat pancreas Cellular location Nucleus Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using Islet1 Rabbit mAb (A0871) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded mouse fetal Heart using Islet1 Rabbit mAb (A0871) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Islet1 (P61371). Isotype IgG