быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SAE1 Rabbit mAb (A0891)
- Описание
- Характеристики
-
Overview
Product name SAE1 Rabbit mAb Catalog No. A0891 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1846 Background
Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SAE1 (Q9UBE0). Sequence DSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMA Gene ID Swiss Prot Synonyms AOS1; SUA1; UBLE1A; HSPC140 Calculated MW 38kDa Observed MW 40kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, MCF7, DU145, Mouse testis Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using SAE1 Rabbit mAb (A0891) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using SAE1 Rabbit mAb (A0891) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SAE1 (Q9UBE0). Isotype IgG