быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
NCF4/p40-phox Rabbit mAb (A0935)
- Описание
- Характеристики
-
Overview
Product name NCF4/p40-phox Rabbit mAb Catalog No. A0935 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2553 Background
The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 240-339 of human NCF4/p40-phox (Q15080). Sequence LRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP Gene ID Swiss Prot Synonyms NCF; CGD3; P40PHOX; SH3PXD4 Calculated MW 39kDa Observed MW 40kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples THP-1, Mouse thymus Cellular location Cytoplasm, Cytoplasmic side, Endosome membrane, Membrane, Peripheral membrane protein, cytosol 
Western blot analysis of extracts of THP-1 cells, using NCF4/p40-phox antibody (A0935) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of Mouse thymus, using NCF4/p40-phox antibody (A0935) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using NCF4/p40-phox Rabbit mAb (A0935) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 300 μg extracts of THP-1 cells using 3 μg NCF4/p40-phox antibody (A0935). Western blot was performed from the immunoprecipitate using NCF4/p40-phox antibody (A0935) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 240-339 of human NCF4/p40-phox (Q15080). Isotype IgG