быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HFE Rabbit mAb (A0937)
- Описание
- Характеристики
-
Overview
Product name HFE Rabbit mAb Catalog No. A0937 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2554 Background
The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 249-348 of human HFE (Q30201). Sequence KEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE Gene ID Swiss Prot Synonyms HH; HFE1; HLA-H; MVCD7; TFQTL2 Calculated MW 40kDa Observed MW 45kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, HT-29, A549 Cellular location Cell membrane 
Western blot analysis of extracts of various cell lines, using HFE antibody (A0937) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 249-348 of human HFE (Q30201). Isotype IgG