быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HLA-DMB Rabbit mAb (A0948)
- Описание
- Характеристики
-
Overview
Product name HLA-DMB Rabbit mAb Catalog No. A0948 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2555 Background
HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HLA-DMB (P28068). Sequence MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATH Gene ID Swiss Prot Synonyms RING7; D6S221E Calculated MW 29kDa Observed MW 29kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HT-29, Raji Cellular location Late endosome membrane, Lysosome membrane, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using HLA-DMB antibody (A0948) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HLA-DMB (P28068). Isotype IgG







