быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Exportin 2 (XPO2) Rabbit mAb (A1041)
- Описание
- Характеристики
-
Overview
Product name Exportin 2 (XPO2) Rabbit mAb Catalog No. A1041 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1856 Background
CSE1L (Chromosome Segregation 1-Like) is located on 20q13.13, and encodes a 971-amino-acid protein. It associates with microtubules and mitotic spindles, and is also considered to have a role in tumor progression. The CSE1L protein includes a nuclear localization signal allowing for transport into the nucleus via the importin-alpha/beta heterodimer. In addition, CSE1L plays roles in cell proliferation and apoptosis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 872-971 of human Exportin 2 (XPO2) (P55060). Sequence LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL Gene ID Swiss Prot Synonyms CAS; CSE1; XPO2 Calculated MW 110kDa Observed MW 105kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, Jurkat, Mouse testis, Mouse thymus Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using Exportin 2 (XPO2) Rabbit mAb (A1041) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 872-971 of human Exportin 2 (XPO2) (P55060). Isotype IgG