быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CREB Rabbit mAb (A10826)
- Описание
- Характеристики
-
Overview
Product name CREB Rabbit mAb Catalog No. A10826 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0113 Background
This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in several transcript variants encoding different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CREB1 (P16220). Sequence ATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR Gene ID Swiss Prot Synonyms CREB; CREB-1 Calculated MW 35kDa Observed MW 43kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse lung, Mouse brain, Rat brain Cellular location Nucleus Customer validation IF(Mus musculus)
WB(Homo sapiens,Mus musculus, Rattus norvegicus)
IP(Homo sapiens,Mus musculus)
IF(Homo sapiens,Mus musculus)
IHC(Homo sapiens)
IF(Homo sapiens)
Western blot analysis of extracts of various cell lines, using CREB1 antibody (A10826) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CREB1 (P16220). Isotype IgG