быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Lysozyme (LYZ) Rabbit mAb (A10972)
- Описание
- Характеристики
-
Overview
Product name Lysozyme (LYZ) Rabbit mAb Catalog No. A10972 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57153 Background
This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (LYZ) (NP_000230.1). Sequence MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCS Gene ID Swiss Prot Synonyms LZM; LYZF1 Calculated MW 17kDa Observed MW 15kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:3000 - 1:20000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples U-937, RAW 264.7, Mouse lung, Rat lung Cellular location Secreted 
Western blot analysis of various lysates, using Lysozyme(LYZ) antibody (A10972) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (LYZ) (NP_000230.1). Isotype IgG