быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Glutaminase (GLS) Rabbit mAb (A11043)
- Описание
- Характеристики
-
Overview
Product name Glutaminase (GLS) Rabbit mAb Catalog No. A11043 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0519 Background
This gene encodes the K-type mitochondrial glutaminase. The encoded protein is an phosphate-activated amidohydrolase that catalyzes the hydrolysis of glutamine to glutamate and ammonia. This protein is primarily expressed in the brain and kidney plays an essential role in generating energy for metabolism, synthesizing the brain neurotransmitter glutamate and maintaining acid-base balance in the kidney. Alternate splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Glutaminase (GLS) (O94925). Sequence MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGGGGWPAEPLARGLSSSPSEILQELGKGSTHPQPGVSPPAAP Gene ID Swiss Prot Synonyms GAC; GAM; KGA; GLS1; AAD20; DEE71; GDPAG; CASGID; EIEE71 Calculated MW 73kDa Observed MW 55-65kDa Applications
Reactivity Human Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T, HepG2, SH-SY5Y Cellular location Cytoplasm, Mitochondrion, cytosol 
Western blot analysis of extracts of various cell lines, using Glutaminase (GLS) (GLS) Rabbit mAb (A11043) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunofluorescence analysis of U-2 OS cells using Glutaminase (GLS) (GLS) Rabbit mAb (A11043) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Glutaminase (GLS) (O94925). Isotype IgG