быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
IL1RA Rabbit mAb (A11103)
- Описание
- Характеристики
-
Overview
Product name IL1RA Rabbit mAb Catalog No. A11103 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0524 Background
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-177 of human IL1RA (NP_776214.1) Sequence ETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE Gene ID Swiss Prot Synonyms DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA Calculated MW 20kDa Observed MW 22kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples TE-1, A-431, NIH/3T3, SW480, Mouse lung, Mouse liver, Rat large intestine, Rat lung Cellular location Cytoplasm, Secreted 
Western blot analysis of extracts of various cell lines, using IL1RA Rabbit mAb (A11103) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using IL1RA Rabbit mAb (A11103) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Confocal imaging of human skin using IL1RA Rabbit mAb (A11103, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 60x.
Confocal imaging of mouse tail ear using IL1RA Rabbit mAb (A11103, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 60x.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-177 of human IL1RA (NP_776214.1) Isotype IgG