быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MMP13 Rabbit mAb (A11148)
- Описание
- Характеристики
-
Overview
Product name MMP13 Rabbit mAb Catalog No. A11148 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0528 Background
This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. Mutations in this gene are associated with metaphyseal anadysplasia. This gene is part of a cluster of MMP genes on chromosome 11.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human MMP13 (P45452). Sequence RGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQF Gene ID Swiss Prot Synonyms CLG3; MDST; MANDP1; MMP-13 Calculated MW 54kDa Observed MW 60kDa Applications
Reactivity Human Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples A549, MCF7 Cellular location Secreted, extracellular matrix, extracellular space Customer validation WB(Gallus gallus, Homo sapiens, Mus musculus, Rattus norvegicus)
IF(Homo sapiens)
WB(Homo sapiens)
IHC(Mus musculus, Rattus norvegicus)
ELISA(Mus musculus)
Western blot analysis of extracts of various cell lines, using MMP13 Rabbit mAb (A11148) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using MMP13 Rabbit mAb (A11148) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Confocal imaging of U-2 OS cells using MMP13 Rabbit mAb (A11148, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human MMP13 (P45452). Isotype IgG