быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MGMT Rabbit mAb (A11151)
- Описание
- Характеристики
-
Overview
Product name MGMT Rabbit mAb Catalog No. A11151 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0529 Background
Alkylating agents are potent carcinogens that can result in cell death, mutation and cancer. The protein encoded by this gene is a DNA repair protein that is involved in cellular defense against mutagenesis and toxicity from alkylating agents. The protein catalyzes transfer of methyl groups from O(6)-alkylguanine and other methylated moieties of the DNA to its own molecule, which repairs the toxic lesions. Methylation of the genes promoter has been associated with several cancer types, including colorectal cancer, lung cancer, lymphoma and glioblastoma.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 108-207 of human MGMT (NP_002403.3). Sequence FGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN Gene ID Swiss Prot Synonyms MGMT; O-6-methylguanine-DNA methyltransferase Calculated MW 22kDa Observed MW 22kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, MCF7, Jurkat Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using MGMT Rabbit mAb (A11151) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 108-207 of human MGMT (NP_002403.3). Isotype IgG