быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD3H Rabbit mAb (A11157)
- Описание
- Характеристики
-
Overview
Product name CD3H Rabbit mAb Catalog No. A11157 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0533 Background
The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 65-164 of human CD3H (P20963). Sequence QQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR Gene ID Swiss Prot Synonyms T3Z; CD3H; CD3Q; CD3Z; TCRZ; IMD25; CD3ZETA; CD3-ZETA Calculated MW 19kDa Observed MW 16kDa Applications
Reactivity Human Tested applications WB IHC-P FC FC(Intra) Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- FC(Intra) 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Jurkat Cellular location Membrane, Single-pass type I membrane protein 
Western blot analysis of extracts from Jurkat cells, using CD3H Rabbit mAb (A11157) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded human colon using CD3H Rabbit mAb (A11157) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Flow cytometry:1X10^6 Raji cells (negative control, left) and Jurkat cells (right) were intracellularly-stained with CD3H Rabbit mAb(A11157, 10 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 10 μg/mL, blue line), followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 65-164 of human CD3H (P20963). Isotype IgG