быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Insulin-degrading enzyme (IDE) Rabbit mAb (A11190)
- Описание
- Характеристики
-
Overview
Product name Insulin-degrading enzyme (IDE) Rabbit mAb Catalog No. A11190 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0537 Background
This gene encodes a zinc metallopeptidase that degrades intracellular insulin, and thereby terminates insulins activity, as well as participating in intercellular peptide signalling by degrading diverse peptides such as glucagon, amylin, bradykinin, and kallidin. The preferential affinity of this enzyme for insulin results in insulin-mediated inhibition of the degradation of other peptides such as beta-amyloid. Deficiencies in this protein's function are associated with Alzheimer's disease and type 2 diabetes mellitus but mutations in this gene have not been shown to be causitive for these diseases. This protein localizes primarily to the cytoplasm but in some cell types localizes to the extracellular space, cell membrane, peroxisome, and mitochondrion. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described but have not been experimentally verified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Insulin-degrading enzyme (IDE) (P14735). Sequence MRYRLAWLLHPALPSTFRSVLGARLPPPERLCGFQKKTYSKMNNPAIKRIGNHITKSPEDKREYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDP Gene ID Swiss Prot Synonyms INSULYSIN Calculated MW 118kDa Observed MW 118kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, K-562, U-87MG, Mouse brain, Rat brain Cellular location Cell membrane, Cytoplasm, Secreted 
Western blot analysis of extracts of various cell lines, using Insulin-degrading enzyme (Insulin-degrading enzyme (IDE)) Rabbit mAb (A11190) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Insulin-degrading enzyme (IDE) (P14735). Isotype IgG







