быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Complement C3 Rabbit mAb (A11196)
- Описание
- Характеристики
-
Overview
Product name Complement C3 Rabbit mAb Catalog No. A11196 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0541 Background
Complement component C3 plays a central role in the activation of complement system. Its activation is required for both classical and alternative complement activation pathways. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that form the mature protein, which is then further processed to generate numerous peptide products. The C3a peptide, also known as the C3a anaphylatoxin, modulates inflammation and possesses antimicrobial activity. Mutations in this gene are associated with atypical hemolytic uremic syndrome and age-related macular degeneration in human patients.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Complement Complement C3 (P01024). Sequence GRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQL Gene ID Swiss Prot Synonyms ASP; C3a; C3b; AHUS5; ARMD9; CPAMD1; HEL-S-62p Calculated MW 187kDa Observed MW 115kDa/187kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2 Cellular location Secreted 
Western blot analysis of extracts of HepG2 cells, using Complement Complement C3 Rabbit mAb (A11196) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Complement Complement C3 (P01024). Isotype IgG







