быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Aquaporin-4 (AQP4) Rabbit mAb (A11210)
- Описание
- Характеристики
-
Overview
Product name Aquaporin-4 (AQP4) Rabbit mAb Catalog No. A11210 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54345 Background
This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. This protein is the predominant aquaporin found in brain and has an important role in brain water homeostasis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. Additional isoforms, resulting from the use of alternative in-frame translation initiation codons, have also been described. Recent studies provided evidence for translational readthrough in this gene, and expression of C-terminally extended isoforms via the use of an alternative in-frame translation termination codon.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 256-323 of human Aquaporin-4 (AQP4) (NP_001641.1). Sequence VEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV Gene ID Swiss Prot Synonyms MIWC; WCH4; hAQP4 Calculated MW 32KDa/34kDa Observed MW 35kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples SKOV3, Mouse brain, Rat brain Cellular location Membrane, Multi-pass membrane protein Customer validation IHC(Homo sapiens)
Western blot analysis of various lysates, using Aquaporin-4 (AQP4) Rabbit mAb (A11210) at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human brain using Aquaporin-4 (AQP4) Rabbit mAb (A11210) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse brain using Aquaporin-4 (AQP4) Rabbit mAb (A11210) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat kidney using Aquaporin-4 (AQP4) Rabbit mAb (A11210) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Confocal imaging of human brain using Aquaporin-4 (AQP4) Rabbit mAb (A11210, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 40x.Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 256-323 of human Aquaporin-4 (AQP4) (NP_001641.1). Isotype IgG