быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
FABP1 Rabbit mAb (A11213)
- Описание
- Характеристики
-
Overview
Product name FABP1 Rabbit mAb Catalog No. A11213 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0545 Background
This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FABP1 (P07148). Sequence MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKS Gene ID Swiss Prot Synonyms FABPL; L-FABP Calculated MW 14kDa Observed MW 14kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HepG2, Mouse liver, Mouse small intestine, Rat liver Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using FABP1 Rabbit mAb (A11213) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunofluorescence analysis of NIH-3T3 cells using FABP1 Rabbit mAb (A11213) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using FABP1 Rabbit mAb (A11213) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FABP1 (P07148). Isotype IgG