быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ATP5A1 Rabbit mAb (A11217)
- Описание
- Характеристики
-
Overview
Product name ATP5A1 Rabbit mAb Catalog No. A11217 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0549 Background
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, using an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the alpha subunit of the catalytic core. Alternatively spliced transcript variants encoding the different isoforms have been identified. Pseudogenes of this gene are located on chromosomes 9, 2, and 16.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATP5A1 (P25705). Sequence VPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF Gene ID Swiss Prot Synonyms OMR; ORM; ATPM; MOM2; ATP5A; hATP1; ATP5A1; MC5DN4; ATP5AL2; COXPD22; HEL-S-123m Calculated MW 60kDa Observed MW 55kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- IP 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples 293T, A549, Mouse liver, Mouse heart, Rat brain Cellular location Cell membrane, Extracellular side, Mitochondrion inner membrane, Peripheral membrane protein Customer validation (293T, Hela, A549, HepG2, PC-3, HL-60, RPMI-8226, MOLT-4)
WB(Homo sapiens, Mus musculus)
IHC(Rattus norvegicus)
Western blot analysis of extracts of various cell lines, using ATP5A1 Rabbit mAb (A11217) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry of paraffin-embedded human colon carcinoma using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human kidney using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human liver cancer using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human lung squamous carcinoma tissue using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human thyroid cancer using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat liver using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Confocal imaging of NIH/3T3 cells using ATP5A1 Rabbit mAb (A11217, dilution 1:100) (Green). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC039, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 60x.
Immunoprecipitation analysis of 600 μg extracts of Mouse heart cells using 3 μg ATP5A1 antibody (A11217). Western blot was performed from the immunoprecipitate using ATP5A1 antibody (A11217) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATP5A1 (P25705). Isotype IgG