быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Ku70 Rabbit mAb (A11223)
- Описание
- Характеристики
-
Overview
Product name Ku70 Rabbit mAb Catalog No. A11223 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0551 Background
The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-609 of human Ku70 (P12956). Sequence PEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD Gene ID Swiss Prot Synonyms ML8; KU70; TLAA; CTC75; CTCBF; G22P1 Calculated MW 70kDa Observed MW 70kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, 293T, Jurkat Cellular location Chromosome, Nucleus Customer validation (U87-MG 、HepG2 、SHP-77)
Western blot analysis of extracts from various cell lines, using Ku70 Rabbit mAb (A11223) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Ku70 Rabbit mAb (A11223) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Confocal imaging of U-2 OS cells using Ku70 Rabbit mAb (A11223, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-609 of human Ku70 (P12956). Isotype IgG