быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MIF Rabbit mAb (A11231)
- Описание
- Характеристики
-
Overview
Product name MIF Rabbit mAb Catalog No. A11231 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0552 Background
This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human MIF (NP_002406.1). Sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA Gene ID Swiss Prot Synonyms GIF; GLIF; MMIF Calculated MW 12kDa Observed MW 12kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, HL-60, U-87MG, Mouse liver, Mouse brain, Mouse kidney, Rat liver, Rat brain, Rat kidney Cellular location Cytoplasm, Secreted Customer validation ( 293T、 HeLa 、HCT-116 、 HL-60 、 PC-3、T-47D、 U-87 MG 、Ramos、)
Western blot analysis of extracts of various cell lines, using MIF Rabbit mAb (A11231) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
-
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human MIF (NP_002406.1). Isotype IgG