быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
G6PD Rabbit mAb (A11234)
- Описание
- Характеристики
-
Overview
Product name G6PD Rabbit mAb Catalog No. A11234 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0553 Background
This gene encodes glucose-6-phosphate dehydrogenase. This protein is a cytosolic enzyme encoded by a housekeeping X-linked gene whose main function is to produce NADPH, a key electron donor in the defense against oxidizing agents and in reductive biosynthetic reactions. G6PD is remarkable for its genetic diversity. Many variants of G6PD, mostly produced from missense mutations, have been described with wide ranging levels of enzyme activity and associated clinical symptoms. G6PD deficiency may cause neonatal jaundice, acute hemolysis, or severe chronic non-spherocytic hemolytic anemia. Two transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human G6PD (P11413). Sequence VYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVG Gene ID Swiss Prot Synonyms G6PD1 Calculated MW 59kDa Observed MW 59kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, MCF7 Cellular location Cytoplasm, Cytoplasmic side of plasma membrane, cytosol, Extracellular exosome, Nucleus 
Western blot analysis of extracts of various cell lines, using G6PD Rabbit mAb (A11234) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human G6PD (P11413). Isotype IgG







