быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD55 Rabbit mAb (A11283)
- Описание
- Характеристики
-
Overview
Product name CD55 Rabbit mAb Catalog No. A11283 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0568 Background
This gene encodes a glycoprotein involved in the regulation of the complement cascade. Binding of the encoded protein to complement proteins accelerates their decay, thereby disrupting the cascade and preventing damage to host cells. Antigens present on this protein constitute the Cromer blood group system (CROM). Alternative splicing results in multiple transcript variants. The predominant transcript variant encodes a membrane-bound protein, but alternatively spliced transcripts may produce soluble proteins.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CD55 (P08174). Sequence EGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLK Gene ID Swiss Prot Synonyms CR; TC; DAF; CROM; CHAPLE Calculated MW 41kDa Observed MW 78kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HepG2, A-549 Cellular location Cell membrane, GPI-anchor, Lipid-anchor, Secreted, Single-pass type I membrane protein Customer validation (Hela 、PC-3)
WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using CD55 Rabbit mAb (A11283) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunohistochemistry analysis of paraffin-embedded human placenta using CD55 Rabbit mAb (A11283) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CD55 (P08174). Isotype IgG