быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GC1q R/C1QBP Rabbit mAb (A11292)
- Описание
- Характеристики
-
Overview
Product name GC1q R/C1QBP Rabbit mAb Catalog No. A11292 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2753 Background
The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human GC1q R/C1QBP (Q07021). Sequence KTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAE Gene ID Swiss Prot Synonyms p32; HABP1; gC1qR; GC1QBP; SF2p32; gC1Q-R; COXPD33; SF2AP32 Calculated MW 31kDa Observed MW 33kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, HCT116, SW620, 293T, C2C12, Mouse ovary, Mouse pancreas, Rat brain, Rat heart Cellular location Cell membrane, Cytoplasm, Extracellular side, Mitochondrion matrix, Nucleus, Peripheral membrane protein, Secreted, nucleolus 
Western blot analysis of extracts of various cell lines, using GC1q R/C1QBP antibody (A11292) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using GC1q R/C1QBP antibody (A11292) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using GC1q R/C1QBP antibody (A11292) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse heart using GC1q R/C1QBP antibody (A11292) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using GC1q R/C1QBP antibody (A11292) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat kidney using GC1q R/C1QBP antibody (A11292) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat ovary using GC1q R/C1QBP antibody (A11292) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human GC1q R/C1QBP (Q07021). Isotype IgG