быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CXCR3 Rabbit mAb (A11294)
- Описание
- Характеристики
-
Overview
Product name CXCR3 Rabbit mAb Catalog No. A11294 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0570 Background
This gene encodes a G protein-coupled receptor with selectivity for three chemokines, termed CXCL9/Mig (monokine induced by interferon-g), CXCL10/IP10 (interferon-g-inducible 10 kDa protein) and CXCL11/I-TAC (interferon-inducible T cell a-chemoattractant). Binding of chemokines to this protein induces cellular responses that are involved in leukocyte traffic, most notably integrin activation, cytoskeletal changes and chemotactic migration. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the isoforms (CXCR3-B) shows high affinity binding to chemokine, CXCL4/PF4 (PMID:12782716).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CXCR3 (P49682). Sequence ATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK Gene ID Swiss Prot Synonyms GPR9; MigR; CD182; CD183; Mig-R; CKR-L2; CMKAR3; IP10-R Calculated MW 41kDa Observed MW 46kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples K-562 Cellular location Cell membrane, Multi-pass membrane protein, external side of plasma membrane 
Western blot analysis of extracts of K-562 cells, using CXCR3 Rabbit mAb (A11294) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunofluorescence analysis of mouse spleen using CXCR3 Rabbit mAb (A11294) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CXCR3 (P49682). Isotype IgG