быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Myoglobin Rabbit mAb (A11368)
- Описание
- Характеристики
-
Overview
Product name Myoglobin Rabbit mAb Catalog No. A11368 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0582 Background
This gene encodes a member of the globin superfamily and is predominantly expressed in skeletal and cardiac muscles. The encoded protein forms a monomeric globular haemoprotein that is primarily responsible for the storage and facilitated transfer of oxygen from the cell membrane to the mitochondria. This protein also plays a role in regulating physiological levels of nitric oxide. Multiple transcript variants encoding distinct isoforms exist for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 55-154 of human Myoglobin (P02144). Sequence EMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG Gene ID Swiss Prot Synonyms MYOSB; PVALB Calculated MW 17kDa Observed MW 17kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse skeletal muscle, Mouse heart, Rat skeletal muscle, Rat heart Cellular location cytosol, extracellular exosome Customer validation WB(Mus musculus)
Western blot analysis of extracts of various cell lines, using Myoglobin Rabbit mAb (A11368) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 55-154 of human Myoglobin (P02144). Isotype IgG