быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GCLM Rabbit mAb (A11444)
- Описание
- Характеристики
-
Overview
Product name GCLM Rabbit mAb Catalog No. A11444 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0597 Background
Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia. Alternative splicing results in multiple transcript variants encoding different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 175-274 of human GCLM (P48507). Sequence LYQWAQVKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAHEWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS Gene ID Swiss Prot Synonyms GLCLR Calculated MW 31kDa Observed MW 30kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-2OS, HeLa, A-431 Cellular location cytosol 
Western blot analysis of extracts of various cell lines, using GCLM antibody (A11444) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 175-274 of human GCLM (P48507). Isotype IgG